- Home
- WWE Survivor Series
- WWE Survivor Series Season 12 Episode 5







WWE Survivor Series Season 12 Episode 5
N/A
Views: 7
Serie: WWE Survivor Series
Director: Kevin Dunn
Guest Star: A.J. Styles, Austin Jenkins, Brock Lesnar, Bryan Danielson, Chris Lindsey, Pamela Martinez, Pete Dunne, Rebecca Quin, Rey Mysterio, Shayna Andrea Baszler, Windham Rotunda
Year: 2019
Selling It: In the ATL
ABOUTTHESHOWAtlantaisboomingandwomenaretakingovertherealestategame.TensionsriseassevenrealtorscompetetoclaimtheirstakeinprimeATLproperties.WithclientsrangingfromNFLplayersandmusicindustrygiantstoCEOsandforeigndiplomats,thesebosswomenusetheirbusinessacumenandlargepersonalitiestoclosedeals.WhentheOldandNewSouthclashandalliancesshift,canprofitsprevailoverpersonaldrama?
Ninja Warriors UK
Divided States
An in-depth look at how racial tensions and hate crimes are impacting communities in the United States and Europe, and how community members are confronting the problem and fighting back.
Residue
Thegovernmentcover-upofthecausesbehindamassiveexplosioninafuturisticUKmetropolisspurphotojournalistJenniferPrestonontosearchforthetruthandintheprocessblowopenaparanormalphenomenonhauntingthecity.
Awake
Michael lives in two separate realities after a car accident. In one reality, his wife Hannah survives the accident; in the other reality, his son Rex survives. Michael does not…
Britain’s Biggest Warship
HMS Queen Elizabeth is the largest and most advanced warship ever constructed in Britain. As she embarks on gruelling sea trials we see ship and crew pushed to breaking point.
First Wives Club
The Gary Owen Show
Made in Chelsea
It’s time to peek behind the designer curtains of South West London and meet London’s young socially elite, Made in Chelsea. Yes, they’re immaculately dressed; yes, they are fiercely ambitious;…
Billion Dollar Wreck
MartinBayerle,whofirstlocatedthesunkenRMSRepublicin270feetofwatersouthoftheislandNantucketin1981,makeshissecondmajorrecoverymissiontothewreck.Thevessel,builtin1903andsunkwhenshewasinadvertentlyrimmedbroadsideinpoorvisibilityin1909,isrumoredtohaveonboarduntoldmillionsinface-valuegoldcoins-anamountthatcouldexceed$1Billionintoday’scurrencyvalues.Bayerle,whowasonceimprisonedformanslaughteraftershootingandkillingamanwhowashavinganaffairwithhiswifeandattemptedtoextortmoneyfromBayerletoleave,maypossessbetterinformationastowhereonthewreckagethegoldmayrest;he’sassembledagroupofprovensalvers,includinghisownson,todive,explore,andifpossiblerecovertheentombedriches.Writtenbyjb0579