On the 30th anniversary of his Florida execution, CONVERSATIONS WITH A KILLER: THE TED BUNDY TAPES brings the infamously twisted mind of serial killer Ted Bundy into the light for…

A crime she committed in her youthful past sends Piper Chapman to a women’s prison, where she trades her comfortable New York life for one of unexpected camaraderie and conflict…

A comedic drama about a group of rogue CIA spies in the Office of Disruptive Services (ODS), who combat threats to national security amidst bureaucratic gridlock, rampant incompetence and political…

After crash-landing on an alien planet, the Robinson family fights against all odds to survive and escape. But they’re surrounded by hidden dangers.

Thom Payne is a 44 year-old man whose world is thrown into disarray when his 25 year-old “wunderkind” boss arrives, saying things like “digital,” “social” and “viral.” Is he in…

Reexamining some of the most high-profile and controversial cases in history through the eyes of the people who served on the original jury. Each episode delves into a new case…

Looking at the lives of former and current football players, the show follows former superstar Spencer Strasmore as he gets his life on track in retirement while mentoring other current…

This anthology series is a post-modernist reinvention of older movies that turns pre-existing imagery from the public domain on its head to tell brand new unique stories spanning genres including…

Theresa Caputo is an average mom from Long Island in every way except one: she talks to the dead. Theresa spends her days with her loving family and helping individuals…

BadehotelletisthestoryabouttheguestsandstaffatabeachhotelbytheNorthSeasanddunes.Attheheartofthestoryisthelivesofthreeyoungpeople,thechambermaidFie,themerchant’sdaughterAmanda,andthelocalfishermanMorten.Theirfatesareintertwined,andtheirstoriesareaboutemancipatingthemselvesfromtheplansotherpeoplehavemadeontheirbehalf,theattemptsonsocialascent,andaboutlosingandfindingoneselfontheway.Theseriesisinspiredbythewayoflifeatthemanyseasidehotelsofthepast,andreflectsourowntimewithitsmixtureoffinancialcrisis,denial,anddreamsofhappiness.Thestorytakesplaceintheyears1928-33wheretheworldisfallingapart.Thecharacterswillgothroughtearsandlaughterinthecaptivatingjourneythattakesplaceastimeschangefromoptimismtocrisis.It’samulti-plot-seriesthatdynamicallyshiftsbetweenupstairsanddownstairs,andbetweenseriousnessandhumour.WrittenbyBadehotellet

A narco kingpin escapes from a high-security Mexican prison with his son and finds refuge at a remote drug rehab facility located on the U.S. side of the border where…

Follows two delusional brothers, who are self-proclaimed filmmakers, as they are kicked out of their parent’s house and end up on an epic cinematic journey.