- Home
- Tales from the Darkside
- Tales from the Darkside Season 3 Episode 6
Tales from the Darkside Season 3 Episode 6
Audrey Webster is concerned about her reclusive mother, but when she pursues the matter discovers exactly why her mother stays away from others, and what awaits Audrey on her own upcoming wedding night.
Views: 10
Serie: Tales from the Darkside
Director: George A. Romero, Stephen King
Guest Star: Margaret O'Brien, Theresa Saldana
Come Dance with Me
In the series, exceptionally talented young dancers from across the country will invite one inspirational, and untrained, family member or other adult who has supported their dance dreams, to become…
Deadly Recall
AsixpartseriesfollowingahomicidedetectivefromNashvillewhohasaphotographicmemory.SeriespremieringMarch5thontheIDnetwork.
Flipping Ships
EdwinMcCain’spassionformusictookhimstraighttotheTop10.Now,he’schartingnewterritorywithaquirkybandofgearheadsonamissiontosavebeatendownboatsleftfordeadonFlippingShips.SetsailtoGreenville,SouthCarolina,whereEdwinandtheBoatsHaveSoulsrestorationcrewperformactsofnauticalsalvation.
Deep State
What happens when a man who believes he has retired from MI6 is called back to do one more job to regain his life, only to discover that this job…
Curb Your Enthusiasm
Paranormal
Set in the 1960s, the series, packed with mystery and suspense, depicts the adventures of PARANORMAL leading character Dr. Refaat Ismail, a single hematologist who finds himself faced with a…
Residue
Thegovernmentcover-upofthecausesbehindamassiveexplosioninafuturisticUKmetropolisspurphotojournalistJenniferPrestonontosearchforthetruthandintheprocessblowopenaparanormalphenomenonhauntingthecity.
Billion Dollar Wreck
MartinBayerle,whofirstlocatedthesunkenRMSRepublicin270feetofwatersouthoftheislandNantucketin1981,makeshissecondmajorrecoverymissiontothewreck.Thevessel,builtin1903andsunkwhenshewasinadvertentlyrimmedbroadsideinpoorvisibilityin1909,isrumoredtohaveonboarduntoldmillionsinface-valuegoldcoins-anamountthatcouldexceed$1Billionintoday’scurrencyvalues.Bayerle,whowasonceimprisonedformanslaughteraftershootingandkillingamanwhowashavinganaffairwithhiswifeandattemptedtoextortmoneyfromBayerletoleave,maypossessbetterinformationastowhereonthewreckagethegoldmayrest;he’sassembledagroupofprovensalvers,includinghisownson,todive,explore,andifpossiblerecovertheentombedriches.Writtenbyjb0579