Rosemary & Thyme is a British television mystery series starring Felicity Kendal and Pam Ferris as gardening detectives Rosemary Boxer and Laura Thyme. The show began on ITV in 2003….

Leave It to Beaver is an American television situation comedy about an inquisitive and often naïve boy named Theodore “The Beaver” Cleaver and his adventures at home, in school, and…

This iconic family—Dan, Jackie, Darlene, Becky and D.J.—grapples with parenthood, dating, an unexpected pregnancy, financial pressures, aging and in-laws in working-class America.

MartinBayerle,whofirstlocatedthesunkenRMSRepublicin270feetofwatersouthoftheislandNantucketin1981,makeshissecondmajorrecoverymissiontothewreck.Thevessel,builtin1903andsunkwhenshewasinadvertentlyrimmedbroadsideinpoorvisibilityin1909,isrumoredtohaveonboarduntoldmillionsinface-valuegoldcoins-anamountthatcouldexceed$1Billionintoday’scurrencyvalues.Bayerle,whowasonceimprisonedformanslaughteraftershootingandkillingamanwhowashavinganaffairwithhiswifeandattemptedtoextortmoneyfromBayerletoleave,maypossessbetterinformationastowhereonthewreckagethegoldmayrest;he’sassembledagroupofprovensalvers,includinghisownson,todive,explore,andifpossiblerecovertheentombedriches.Writtenbyjb0579

Withherjob,relationshipandhomeyankedoutfromunderher,SpencerBergmantriestorebuildherlifewiththehelpofherbestfriend,Thomas.

Food fanatic Adam Richman has held nearly every job in the restaurant biz, and now he’s on a journey to explore the biggest and best eats this nation has to…

Crime reporter, John Moore, meets with psychologist, Dr. Laszlo Kreizler, to investigate a serial killer in New York during the late 19th century.

This anthology series is a post-modernist reinvention of older movies that turns pre-existing imagery from the public domain on its head to tell brand new unique stories spanning genres including…

Captain Planet and the Planeteers is an American animated environmentalist television program created by Ted Turner, Robert Larkin III, and Barbara Pyle, produced by Pyle, Nicholas Boxer, Andy Heyward and…

The adventures of Wander, an eternally-optimistic intergalactic traveler and constant do-gooder, and his quick-tempered but loyal steed and best friend, Sylvia. The friendliest face in outer space, Wander journeys across…

Get ready for BOOM!, the new game show that fuses family entertainment with the thrill and intensity of a blockbuster action movie. Full of comedy, color, tension and excitement, BOOM!…

War as never seen before. Soldiers recount their experiences in one of the worst places of Afghanistan through helmet cameras and testimony years after their tour.