- Home
- Star Trek: Deep Space Nine
- Star Trek: Deep Space Nine Season 2 Episode 6







Star Trek: Deep Space Nine Season 2 Episode 6
A new arrival to the station with a special gravity-based disability appeals to Bashir’s heart; meanwhile an old associate of Quark’s comes to the station to kill the barkeep.
Views: 164
Serie: Star Trek: Deep Space Nine
Director: Winrich Kolbe
Guest Star: Daphne Ashbrook, Don Stark, Peter Crombie, Ron Taylor
The Conners
Billion Dollar Wreck
MartinBayerle,whofirstlocatedthesunkenRMSRepublicin270feetofwatersouthoftheislandNantucketin1981,makeshissecondmajorrecoverymissiontothewreck.Thevessel,builtin1903andsunkwhenshewasinadvertentlyrimmedbroadsideinpoorvisibilityin1909,isrumoredtohaveonboarduntoldmillionsinface-valuegoldcoins-anamountthatcouldexceed$1Billionintoday’scurrencyvalues.Bayerle,whowasonceimprisonedformanslaughteraftershootingandkillingamanwhowashavinganaffairwithhiswifeandattemptedtoextortmoneyfromBayerletoleave,maypossessbetterinformationastowhereonthewreckagethegoldmayrest;he’sassembledagroupofprovensalvers,includinghisownson,todive,explore,andifpossiblerecovertheentombedriches.Writtenbyjb0579
Wrecked
Man v. Food
Food fanatic Adam Richman has held nearly every job in the restaurant biz, and now he’s on a journey to explore the biggest and best eats this nation has to…
Cinema Toast
This anthology series is a post-modernist reinvention of older movies that turns pre-existing imagery from the public domain on its head to tell brand new unique stories spanning genres including…
Captain Planet and the Planeteers
Captain Planet and the Planeteers is an American animated environmentalist television program created by Ted Turner, Robert Larkin III, and Barbara Pyle, produced by Pyle, Nicholas Boxer, Andy Heyward and…
Wander Over Yonder
The adventures of Wander, an eternally-optimistic intergalactic traveler and constant do-gooder, and his quick-tempered but loyal steed and best friend, Sylvia. The friendliest face in outer space, Wander journeys across…
Boom!
Get ready for BOOM!, the new game show that fuses family entertainment with the thrill and intensity of a blockbuster action movie. Full of comedy, color, tension and excitement, BOOM!…
Taking Fire
War as never seen before. Soldiers recount their experiences in one of the worst places of Afghanistan through helmet cameras and testimony years after their tour.