From the producers of Ancient Aliens and The Curse of Oak Island comes The UnXplained, a one-hour, non-fiction series that explores the world’s most fascinating, strange and inexplicable mysteries. Hosted…

Afactualentertainmentseriesthatseesthecountry’sbiggestandbrashestbuildersgoinghead-to-headpitchingforjobsandbringinghomeownersdesigndreamstolife.

The lives of three women in their 30s, as they navigate the challenges of life, love and relationships. Whilst everyone else is settling down, married with kids, and increasingly in…

Cast members of Nickelodeon shows play games, spill secrets and recap episodes.

By day the workplace is rational and efficient, but at night the same offices, hotels and restaurants become the domain of the supernatural and unexplained. Those who work the graveyard…

BadehotelletisthestoryabouttheguestsandstaffatabeachhotelbytheNorthSeasanddunes.Attheheartofthestoryisthelivesofthreeyoungpeople,thechambermaidFie,themerchant’sdaughterAmanda,andthelocalfishermanMorten.Theirfatesareintertwined,andtheirstoriesareaboutemancipatingthemselvesfromtheplansotherpeoplehavemadeontheirbehalf,theattemptsonsocialascent,andaboutlosingandfindingoneselfontheway.Theseriesisinspiredbythewayoflifeatthemanyseasidehotelsofthepast,andreflectsourowntimewithitsmixtureoffinancialcrisis,denial,anddreamsofhappiness.Thestorytakesplaceintheyears1928-33wheretheworldisfallingapart.Thecharacterswillgothroughtearsandlaughterinthecaptivatingjourneythattakesplaceastimeschangefromoptimismtocrisis.It’samulti-plot-seriesthatdynamicallyshiftsbetweenupstairsanddownstairs,andbetweenseriousnessandhumour.WrittenbyBadehotellet

AriShaffirandtwo(sometimesthree)othercomedianstelltheirhilariousreallifestoriesbasedonspecificsubjects.RoyWoodJr.replacesAriashostinseason4.

A boy’s brutal murder and the public trials of his guardians and social workers prompt questions about the system’s protection of vulnerable children.

Journalist Susan Zalkind investigates the triple murder that took her friend’s life, the national tragedy that shook her city, and the haunting question that connects the two events: if the…

In this contemporary take on the beloved book series, five best friends launch a baby-sitting business that’s big on fun and adventure.

A complex thriller revolving around three characters, each with troubling pasts clouding their intersecting motives: Emma is a young woman who once loved a dangerous killer, John is a former…

Threesiblingsareallwaitingforonething.Thattheirrich,evil,self-righteousgrandfatherwilldiesotheycaninherithisfortuneandthussolvealloftheirproblemsinlife.