- Home
- Ryan Hansen Solves Crimes on Television
- Ryan Hansen Solves Crimes on Television Season 1 Episode 7







Ryan Hansen Solves Crimes on Television Season 1 Episode 7
Seven public domain princesses are murdered, and Ryan and Mathers need to solve the case before the killer strikes again. Kristen Bell guest stars in an unlikely role.
Views: 29
Serie: Ryan Hansen Solves Crimes on Television
Director: Rawson Marshall Thurber
Guest Star: Aly Michalka, Evangeline Lindes, Jon Cryer, Karen David, Noelle E Parker, Ryan Hansen, Samira Wiley, Sydney Brower
Shaun the Sheep
Shaun the Sheep is a British stop-motion animated children’s television series produced by Aardman Animations, and commissioned by the British Broadcasting Corporation and Westdeutscher Rundfunk, a constituent member of the…
True Life/Now
MTV’sEmmyAward-winningdocumentaryseriesreturnswithanewfranchise;uncoveringstoriesofrealpeopleimmersedintoday’sbiggestsocialphenomena.
Facing
Epic tales of opposition against some of the world’s most powerful icons, from Pablo Escobar to Arnold Schwarzenegger. Explore the public figures’ minds and motivations through rare archival footage and…
Couples Come Dine with Me
Three couples from Leeds compete to host the best dinner party, beginning with construction manager Martin and his wife Amanda, who are determined to win. They are rivalled by competitive…
Badehotellet
BadehotelletisthestoryabouttheguestsandstaffatabeachhotelbytheNorthSeasanddunes.Attheheartofthestoryisthelivesofthreeyoungpeople,thechambermaidFie,themerchant’sdaughterAmanda,andthelocalfishermanMorten.Theirfatesareintertwined,andtheirstoriesareaboutemancipatingthemselvesfromtheplansotherpeoplehavemadeontheirbehalf,theattemptsonsocialascent,andaboutlosingandfindingoneselfontheway.Theseriesisinspiredbythewayoflifeatthemanyseasidehotelsofthepast,andreflectsourowntimewithitsmixtureoffinancialcrisis,denial,anddreamsofhappiness.Thestorytakesplaceintheyears1928-33wheretheworldisfallingapart.Thecharacterswillgothroughtearsandlaughterinthecaptivatingjourneythattakesplaceastimeschangefromoptimismtocrisis.It’samulti-plot-seriesthatdynamicallyshiftsbetweenupstairsanddownstairs,andbetweenseriousnessandhumour.WrittenbyBadehotellet
X-Men: Evolution
X-Men: Evolution is an American animated television series about the Marvel Comics superhero team X-Men. In this incarnation, many of the characters are teenagers rather than adults. The series ran…
Flipped
Chronically underemployed couple Jann and Cricket Melfi are self-proclaimed home renovation “experts” who are more than confident they are television’s next great home design celebrity duo. The clueless pair’s dreams…
Safe Harbour
Lego Star Wars: The Force Awakens
30yearsafterthedestructiveBattleofEndor,anewthreatemergesfromthebricksoftheoldEmpire,theFirstOrder.Theirplan:toendtheNewRepublicandtheResistance,completetheirultimateweapon,andtakeoverthegalaxy.Luckily,hopeisnotlost.Ascavenger,aroguestormtrooper,andtheResistance’sbestpilotmustcometogetherwiththeaidofoldalliestoendtheFirstOrder’splansbrickbybrick.ThemostbelovedLEGOvideogamefranchisebyTraveler’sTalesreturnstotakeyoubacktoalongtimeagoinagalaxyfar,farawaywithLEGOStarWars:TheForceAwakens-TheVideogame!WrittenbyChaseSlaughter