- Home
- Johnny Bravo
- Johnny Bravo Season 1 Episode 1
Johnny Bravo Season 1 Episode 1
Johnny has to track down a gorilla that escaped from the zoo.
Views: 71
Serie: Johnny Bravo
Director: Van Partible
Guest Star: Brenda Vaccaro, Jeff Bennett, Larry Drake, Mae Whitman, Tom Kenny
Tokyo Ghoul
Ken Kaneki is a bookworm college student who meets a girl names Rize at a cafe he frequents. They’re the same age and have the same interests, so they quickly…
Heartbeat
Based on the real life and achievements of Dr. Kathy Magliato, this unique character-driven medical drama follows Dr. Alex Panttiere, an outspoken world-renowned heart-transplant surgeon and one of the few…
Residue
Thegovernmentcover-upofthecausesbehindamassiveexplosioninafuturisticUKmetropolisspurphotojournalistJenniferPrestonontosearchforthetruthandintheprocessblowopenaparanormalphenomenonhauntingthecity.
Z Nation
Three years after the zombie virus has gutted the country, a team of everyday heroes must transport the only known survivor of the plague from New York to California, where…
Scene of the Crime with Tony Harris
My Online Nightmare
Accountsofsomeofthemostextraordinarytalesofscammersandfraudsterswhohaveusedtheinternettofindtheirvictimsandtolureandconthem,withterrifyingandsometimesdeadlyresults.
The Origins of Coronavirus Explained in 1 Minute
TheCOVID-19virus,oftenreferredtoastheCorona-virus,isbelievedtohaveoriginatedfromaso-calledwetmarketinWuhan,wherewildanimalshavebeenshovedintocrowdedcagesalongsideeachother,readytobekilledandcookedinfrontofcustomers.Insuchplaces,youcaneasilybeexposedtoinfectiousdiseases.Thisvideoalsoprovidesusacloserlookatthefascinatingmammal,thepangolin,thatisunfortunatelythemosttraffickedanimalspeciesintheworld.Writtenbychribren
Law & Order: Criminal Intent
The third installment of the “Law & Order” franchise takes viewers deep into the minds of its criminals while following the intense psychological approaches the Major Case Squad uses to…