MaryAnnEspositocooksdeliciousItaliandishesandteachesusalittlesomethingnewaboutItalyeveryepisode.

The Powerpuff Girls is a animated television series about Blossom, Bubbles, and Buttercup, three kindergarten-aged girls with superpowers, as well as their “father”, the brainy scientist Professor Utonium, who all…

James “Ghost” St. Patrick has it all: a beautiful wife, a gorgeous Manhattan penthouse, and the hottest, up-and-coming new nightclub in New York. His club, Truth, caters to the elite:…

A locally famous radio host has to deal with his ex-wife, who he still loves, and his two children.

BadehotelletisthestoryabouttheguestsandstaffatabeachhotelbytheNorthSeasanddunes.Attheheartofthestoryisthelivesofthreeyoungpeople,thechambermaidFie,themerchant’sdaughterAmanda,andthelocalfishermanMorten.Theirfatesareintertwined,andtheirstoriesareaboutemancipatingthemselvesfromtheplansotherpeoplehavemadeontheirbehalf,theattemptsonsocialascent,andaboutlosingandfindingoneselfontheway.Theseriesisinspiredbythewayoflifeatthemanyseasidehotelsofthepast,andreflectsourowntimewithitsmixtureoffinancialcrisis,denial,anddreamsofhappiness.Thestorytakesplaceintheyears1928-33wheretheworldisfallingapart.Thecharacterswillgothroughtearsandlaughterinthecaptivatingjourneythattakesplaceastimeschangefromoptimismtocrisis.It’samulti-plot-seriesthatdynamicallyshiftsbetweenupstairsanddownstairs,andbetweenseriousnessandhumour.WrittenbyBadehotellet

A look at some of the biggest cases handled by real-life FBI agents and analysts.

HostShaunRobinsonpullsbackthecurtainonthefranchise’smostjaw-dropping,unexpectedmoments.Eachweekshewillbejoinedbyseveralspecialguests,rangingfromnewtofamiliarfaces,astheyaddressthemostnotoriousandunansweredrumors.Nothingisofflimitsandnostonewillbeleftunturned,givingsuperfansthedeepest,mostintimatelookeveratallthestories,dramaandsecretsbehindthe90Dayfranchise.WrittenbyAnonymous

The assorted humiliations, disasters and rare triumphs of four very different twenty-something girls: Hannah, an aspiring writer; Marnie, an art gallery assistant and cousins Jessa and Shoshanna.

A contemporary spy series that follows Daniel Miller, an undercover agent at the CIA station in Berlin, Germany.

RainbowDashisheadingtotheEquestriaGamestrialswiththePonyvilleRelayTeam.HowwillshereactwhenofferedthechancetojointhecompetitiveCloudsdaleteaminstead?

A satirical inversion of the ideal of the perfect American nuclear family, they are an eccentric wealthy family who delight in everything grotesque and macabre, and are never really aware…

By day the workplace is rational and efficient, but at night the same offices, hotels and restaurants become the domain of the supernatural and unexplained. Those who work the graveyard…