- Home
- 12 Monkeys
- 12 Monkeys Season 1 Episode 3







12 Monkeys Season 1 Episode 3
Cole’s search for the location of the virus leads him to 2014, and to a devastating moment in Dr. Railly’s life involving a dangerous outbreak in Haiti.
Residue
Thegovernmentcover-upofthecausesbehindamassiveexplosioninafuturisticUKmetropolisspurphotojournalistJenniferPrestonontosearchforthetruthandintheprocessblowopenaparanormalphenomenonhauntingthecity.
Billion Dollar Wreck
MartinBayerle,whofirstlocatedthesunkenRMSRepublicin270feetofwatersouthoftheislandNantucketin1981,makeshissecondmajorrecoverymissiontothewreck.Thevessel,builtin1903andsunkwhenshewasinadvertentlyrimmedbroadsideinpoorvisibilityin1909,isrumoredtohaveonboarduntoldmillionsinface-valuegoldcoins-anamountthatcouldexceed$1Billionintoday’scurrencyvalues.Bayerle,whowasonceimprisonedformanslaughteraftershootingandkillingamanwhowashavinganaffairwithhiswifeandattemptedtoextortmoneyfromBayerletoleave,maypossessbetterinformationastowhereonthewreckagethegoldmayrest;he’sassembledagroupofprovensalvers,includinghisownson,todive,explore,andifpossiblerecovertheentombedriches.Writtenbyjb0579
Coast Guard Alaska
TheThirdseasonofCoastGuardAlaskatakestheviewerbackintotheworldoftheUnitedStatesCoastGuardstationedinruggedKodiak,AlaskaastheytrainandworkintheharshenvironmentconductingdangerousSearchandRescuemissions(SARs).
Star Trek: The Animated Series
Star Trek: The Animated Series is an animated science fiction television series set in the Star Trek universe following the events of Star Trek: The Original Series of the 1960s….
Babylon 5
Babylon 5 is a five-mile long space station located in neutral space. Built by the Earth Alliance in the 2250s, it’s goal is to maintain peace among the various alien…
The Masked Singer Australia
Led by a formidable guessing panel of Jackie O, Dannii Minogue, Dave Hughes and Lindsay Lohan and hosted by Osher Günsberg, The Masked Singer Australia is part guessing game, part…